Recombinant Human Tartrate Resistant Acid Phosphatase protein (ab157836)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQI AYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
    • Amino acids
      72 to 158
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Type 5 acid phosphatase
    • Acid phosphatase 5 tartrate resistant
    • Acid phosphatase 5, tartrate resistant
    • ACP5
    • EC 3.1.3.2
    • MGC117378
    • PPA5_HUMAN
    • serum band 5 tartrate-resistant acid phosphatase
    • SPENCDI
    • T5ap
    • Tartrate resistant acid ATPase
    • Tartrate resistant acid phosphatase type 5
    • Tartrate resistant acid phosphatase type 5 precursor
    • Tartrate-resistant acid ATPase
    • Tartrate-resistant acid phosphatase type 5
    • TR AP
    • TR-AP
    • TRACP 5
    • TRAP
    • TrATPase
    • Type 5 acid phosphatase
    see all
  • Function
    Involved in osteopontin/bone sialoprotein dephosphorylation. Its expression seems to increase in certain pathological states such as Gaucher and Hodgkin diseases, the hairy cell, the B-cell, and the T-cell leukemias.
  • Sequence similarities
    Belongs to the metallophosphoesterase superfamily. Purple acid phosphatase family.
  • Cellular localization
    Lysosome.
  • Information by UniProt

Images

  • ab157836 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up