Recombinant Human TAS2R10 protein (ab162367)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGL AISRIFLIWIIITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFAT SLSIFYFLKIANFSNYIFLWLKSG
    • Amino acids
      1 to 124
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162367 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC126811
    • MGC126813
    • T2R10
    • T2R10_HUMAN
    • TAS2R10
    • Taste receptor family B member 2
    • Taste receptor type 2 member 10
    • Taste receptor, family B, member 2
    • Taste receptor, type 2, member 10
    • TRB2
    see all
  • Function
    Gustducin-coupled strychnine receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.
  • Tissue specificity
    Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
  • Sequence similarities
    Belongs to the G-protein coupled receptor T2R family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162367 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162367 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162367.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up