Overview

  • Product nameRecombinant Human Tau381 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP10636-4
    • SpeciesHuman
    • SequenceMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPG SETSDAKSTPTAEAEEAGIGDTPSLEDEAAGHVTQARM VSKSKDGTGSDDKKAKGADGKT KIATPRGAAPPGQKGQANATRIPAKT PPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSR SRTPSLPTPPTREP KKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQ PG GGKVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQS KIGSLDNI THVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS GDTSPRHLSNVSSTGSIDMV DSPQLATLADEVSASLAKQGL
    • Amino acids1 to 381

Specifications

Our Abpromise guarantee covers the use of ab84770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • AI413597
    • AW045860
    • DDPAC
    • FLJ31424
    • FTDP 17
    • FTDP17
    • G protein beta1/gamma2 subunit-interacting factor 1
    • MAPTL
    • MGC138549
    • MGC156663
    • Microtubule associated protein tau
    • Microtubule-associated protein tau, isoform 4
    • MSTD
    • Mtapt
    • MTBT1
    • MTBT2
    • PHF tau
    • PPND
    • pTau
    • rCG_32645
    • RNPTAU
    • RP23-136D4.1
    • TAU
    see all
  • RelevanceTau381 promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
  • Cellular localizationCell Membrane and Cytoplasmic

Recombinant Human Tau381 protein images

  • SDS-PAGE showing ab84770 at approximately 54kDa.

References for Recombinant Human Tau381 protein (ab84770)

ab84770 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"