Recombinant Human Tau410 protein (ab72462)

Overview

  • Product nameRecombinant Human Tau410 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP10636-5
    • SpeciesHuman
    • SequenceMAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG TTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTK IATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSP GSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAK SRLQTAPV PMPDLKNVKSKIGSTENLKHQPGGGKVQIVYKPVDLSKVTSKCGSLGNIH HKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFR ENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLA DEVSASLAKQGL
    • Amino acids1 to 410
    • Additional sequence informationThis is full length isoform P10636-5, Tau-C.

Specifications

Our Abpromise guarantee covers the use of ab72462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notes

    This protein is full-length isoform 5, Isoform Tau-C.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • DDPAC
    • FLJ31424
    • FTDP 17
    • FTDP17
    • G protein beta1/gamma2 subunit interacting factor 1
    • MAPT
    • MAPTL
    • MGC138549
    • Microtubuleassociated protein tau
    • MSTD
    • MTBT1
    • MTBT2
    • Neurofibrillary tangle protein
    • Paired helical filament tau
    • PHF tau
    • PPND
    • TAU
    see all
  • RelevanceTau410 or Tau C is a member of the Tau family of proteins. Tau proteins promote microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.
  • Cellular localizationCytoplasm, cytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell projection, axon. Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components.

Recombinant Human Tau410 protein images

  • SDS-PAGE showing ab72462 at approximately 61kDa.

References for Recombinant Human Tau410 protein (ab72462)

ab72462 has not yet been referenced specifically in any publications.

Product Wall

Ab72461: Tau D (383 amino acids long) Ab72462: Tau C (410 amino acids long) Ab72463: Tau E (412 amino acids long) Ab72489: Tau F, only amino acids 1-391

The isoform of ab72462 is the 410 kDa tau protein, also known as Tau-C according to uniProt:
http://www.uniprot.org/uniprot/P10636

Thank you for contacting us.

The link to the UniProt database entry is as follows:
http://pir.uniprot.org/uniprot/P10636

ab72462: P10636-5 corresponds to Tau-3

ab72489: P10636-8 corresponds to Tau-4


If you...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"