Recombinant Human TAX1BP3 protein (ab115716)

Overview

  • Product name
    Recombinant Human TAX1BP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHKLRQGENLILG FSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQV NGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
    • Molecular weight
      16 kDa including tags
    • Amino acids
      1 to 124
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab115716 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Glutaminase interacting protein 3
    • Glutaminase-interacting protein 3
    • Tax interaction protein 1
    • Tax1 (human T cell leukemia virus type I) binding protein 3
    • Tax1 binding protein 3
    • Tax1-binding protein 3
    • Tax1bp3
    • TIP 1
    • TIP-1
    • TIP1
    • TX1B3_HUMAN
    see all
  • Function
    May play a role in the Rho signaling pathway. May act as an inhibitor of the Wnt signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
  • Tissue specificity
    Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
  • Sequence similarities
    Contains 1 PDZ (DHR) domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115716 (3µg).

References

ab115716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up