Recombinant Human TAX1BP3 protein (ab115716)

Overview

  • Product name
    Recombinant Human TAX1BP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHKLRQGENLILG FSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQV NGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
    • Molecular weight
      16 kDa including tags
    • Amino acids
      1 to 124
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab115716 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Glutaminase interacting protein 3
    • Glutaminase-interacting protein 3
    • Tax interaction protein 1
    • Tax1 (human T cell leukemia virus type I) binding protein 3
    • Tax1 binding protein 3
    • Tax1-binding protein 3
    • Tax1bp3
    • TIP 1
    • TIP-1
    • TIP1
    • TX1B3_HUMAN
    see all
  • Function
    May play a role in the Rho signaling pathway. May act as an inhibitor of the Wnt signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
  • Tissue specificity
    Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
  • Sequence similarities
    Contains 1 PDZ (DHR) domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human TAX1BP3 protein images

  • 15% SDS-PAGE showing ab115716 (3µg).

References for Recombinant Human TAX1BP3 protein (ab115716)

ab115716 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up