Recombinant Human TBC1D20 protein (ab165302)

Overview

  • Product name
    Recombinant Human TBC1D20 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALRSAQGDGPTSGHWDGGAEKADFNAKRKKKVAEIHQALNSDPTDVAAL RRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVL LDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIV VTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVN PELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLAYHPLMP IYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFV QFPPSELAREAAAQQQAERTAASTFKDFELASAQQRPDMVLRQRFRGLLR PEDRTKDVLTKPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQ LFP
    • Amino acids
      1 to 403
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110028I04Rik
    • 2810442O16Rik
    • AI414693
    • C20orf140
    • FLJ45119
    • MGC94895
    • RP23 452D3.4
    • TBC1 domain family member 20
    • TBC1 domain family, member 20
    • Tbc1d20
    • TBC20_HUMAN
    see all
  • Function
    May act as a GTPase-activating protein for Rab family protein(s).
  • Sequence similarities
    Contains 1 Rab-GAP TBC domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab165302 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up