Recombinant Human TBC1D25 protein (ab116970)

Overview

  • Product name
    Recombinant Human TBC1D25 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YAGPEDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHA FVCFCGIMKRLAANFHPDGRAMATKFAHLKLLLRHADPDFYQYLQEAGAD DLFFCYRWL
    • Molecular weight
      38 kDa including tags
    • Amino acids
      302 to 410

Specifications

Our Abpromise guarantee covers the use of ab116970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MG81
    • MGC126866
    • MGC126868
    • MGC149731
    • MGC149732
    • OATL1
    • ORNITHINE AMINOTRANSFERASE LIKE 1
    • TBC1 domain family member 25
    • TBC1D25
    • TBC25_HUMAN
    see all
  • Function
    Acts as a GTPase-activating protein specific for RAB33B. Involved in the regulation of autophagosome maturation, the process in which autophagosomes fuse with endosomes and lysosomes.
  • Sequence similarities
    Contains 1 Rab-GAP TBC domain.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle, autophagosome. It is dispersed in the cytoplasm under nutrient-rich conditions. Localizes at autophagosomes under cell starving conditions.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116970 at approximately 37.62kDa.
    Stained with Coomassie Blue.

References

ab116970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up