Recombinant Human TBC1D25 protein (ab116970)

Overview

  • Product nameRecombinant Human TBC1D25 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ3MII6
    • SpeciesHuman
    • SequenceYAGPEDGPHLRALHDLLTTYAVTHPQVSYCQGMSDLASPILAVMDHEGHA FVCFCGIMKRLAANFHPDGRAMATKFAHLKLLLRHADPDFYQYLQEAGAD DLFFCYRWL
    • Molecular weight38 kDa including tags
    • Amino acids302 to 410

Specifications

Our Abpromise guarantee covers the use of ab116970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MG81
    • MGC126866
    • MGC126868
    • MGC149731
    • MGC149732
    • OATL1
    • ORNITHINE AMINOTRANSFERASE LIKE 1
    • TBC1 domain family member 25
    • TBC1D25
    • TBC25_HUMAN
    see all
  • FunctionActs as a GTPase-activating protein specific for RAB33B. Involved in the regulation of autophagosome maturation, the process in which autophagosomes fuse with endosomes and lysosomes.
  • Sequence similaritiesContains 1 Rab-GAP TBC domain.
  • Cellular localizationCytoplasm. Cytoplasmic vesicle, autophagosome. It is dispersed in the cytoplasm under nutrient-rich conditions. Localizes at autophagosomes under cell starving conditions.
  • Information by UniProt

Recombinant Human TBC1D25 protein images

  • 12.5% SDS-PAGE showing ab116970 at approximately 37.62kDa.
    Stained with Coomassie Blue.

References for Recombinant Human TBC1D25 protein (ab116970)

ab116970 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"