Recombinant Human TBC1D8 protein (ab161314)

Overview

  • Product name
    Recombinant Human TBC1D8 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRL PRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPL REVVSIEKME
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AD 3
    • BUB2-like protein 1
    • GRAMD8
    • HBLP1
    • TBC1 domain family member 8
    • TBC1 domain family, member 8 (with GRAM domain)
    • TBC1 domain family, member 8A
    • TBC1D8
    • TBC1D8A
    • TBCD8_HUMAN
    • Vascular Rab-GAP/TBC-containing protein
    • VRP
    see all
  • Function
    May act as a GTPase-activating protein for Rab family protein(s).
  • Sequence similarities
    Contains 2 GRAM domains.
    Contains 1 Rab-GAP TBC domain.
  • Information by UniProt

Images

  • ab161314 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up