Overview

  • Product nameRecombinant Human TBCC protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15814
    • SpeciesHuman
    • SequenceMESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEVERRKQKRQNQ EVEKENSHFFVATFARERAAVEELLERAESVERLEEAASRLQGLQKLIND SVFFLAAYDLRQGQEALARLQAALAERRRGLQPKKRFAFKTRGKDAASST KVDAAPGIPPAVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASE LHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCS DCVLAVACQQLRIHSTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPEID KDFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEERNIQWD
    • Molecular weight64 kDa including tags
    • Amino acids1 to 346

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta tubulin cofactor C
    • CFC
    • TBCC
    • TBCC_HUMAN
    • Tubulin folding cofactor C
    • Tubulin specific chaperone c
    • Tubulin-folding cofactor C
    • Tubulin-specific chaperone C
    see all
  • FunctionTubulin-folding protein; involved in the final step of the tubulin folding pathway.
  • Tissue specificityExpressed in the retina. Expressed in the rod and cone photoreceptors, extending from the inner segments (IS), through the outer nuclear layer (ONL) and into the synapses in the outer plexiform layer (OPL). Strongly expressed to the photoreceptor connecting cilium at the tips of the IS (at protein level).
  • Sequence similaritiesBelongs to the TBCC family.
    Contains 1 C-CAP/cofactor C-like domain.
  • Cellular localizationCytoplasm. Detected predominantly in the photoreceptor connecting cilium.
  • Information by UniProt

Recombinant Human TBCC protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116845 at approximately 64.17 kDa.

References for Recombinant Human TBCC protein (ab116845)

ab116845 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"