Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELSQMSELMGLSVLLGLLALMATAAVARGWLRAGEERSGRPACQKANGF PPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALKSHSGNISCMDFSS NGKYLATCADDRTIRIWSTKDFLQREHRSMRANVELDHATLVRFSPDCRA FIVWLANGDTLRVFKMTKREDGGYTFTATPEDFPKKHKAPVIDIGIANTG KFIMTASSDTTVLIWSLKGQVLSTINTNQMNNTHAAVSPCGRFVASCGFT PDVKVWEVCFGKKGEFQEVVRAFELKGHSAAVHSFAFSNDSRRMASVSKD GTWKLWDTDVEYKKKQDPYLLKTGRFEEAAGAAPCRLALSPNAQVLALAS GSSIHLYNTRRGEKEECFERVHGECIANLSFDITGRFLASCGDRAVRLFH NTPGHRAMVEEMQGHLKRASNESTRQRLQQQLTQAQETLKSLGALKK
    • Amino acids
      1 to 447
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp434N024
    • MGC134739
    • TBL 2
    • Transducin (beta) like 2
    • Transducin beta like 2
    • Transducin beta like 2 protein
    • WBSCR 13
    • WBSCR13
    • Williams Beuren syndrome chromosomal region 13 protein
    • Williams Beuren syndrome chromosome region 13
    • WS beta transducin repeats protein
    • WS betaTRP
    see all
  • Relevance
    TBL2 (Transducin beta like 2) is a member of the beta-transducin protein family. It may be involved in some intracellular signaling pathway. The TBL2 gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Images

  • ab162025 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up