Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNI VAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYS FQ
    • Amino acids
      1 to 102
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C21
    • DC42
    • F box like/WD repeat containing protein TBL1XR1
    • F-box-like/WD repeat-containing protein TBL1XR1
    • FLJ12894
    • IRA1
    • Nuclear receptor corepressor/HDAC3 complex subunit
    • Nuclear receptor corepressor/HDAC3 complex subunit TBLR1
    • TBL1 related protein 1
    • TBL1-related protein 1
    • TBL1R_HUMAN
    • TBL1XR1
    • Transducin (beta) like 1 X linked receptor 1
    • Transducin beta like 1X related protein 1
    • Transducin beta-like 1X-related protein 1
    see all
  • Function
    F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of the N-Cor corepressor complex that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of N-Cor complex, thereby allowing cofactor exchange, and transcription activation.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the WD repeat EBI family.
    Contains 1 F-box-like domain.
    Contains 1 LisH domain.
    Contains 8 WD repeats.
  • Domain
    The F-box-like domain is related to the F-box domain, and apparently displays the same function as component of ubiquitin E3 ligase complexes.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153511 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up