Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFS MPSRLISGSNHLKVNDDSQVSFGEGKCNHVHWYPAINHY
    • Amino acids
      431 to 519
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162382 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ABERS
    • CLPA
    • CPX
    • D230020M15Rik
    • dJ795G23.1
    • T box 22
    • T box protein 22
    • T box transcription factor TBX22
    • T-box protein 22
    • T-box transcription factor TBX22
    • Tbx22
    • TBX22_HUMAN
    • TBXX
    see all
  • Function
    Probable transcriptional regulator involved in developmental processes. This is major determinant crucial to palatogenesis.
  • Tissue specificity
    Seems to be expressed at a low level.
  • Involvement in disease
    Defects in TBX22 are the cause of X-linked cleft palate with ankyloglossia (CPX) [MIM:303400].
  • Sequence similarities
    Contains 1 T-box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162382 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162382 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162382.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up