Overview

  • Product name
    Recombinant Human Tbx3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAE SKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      331 to 430

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glycerol, 0.79% Tris HCl

General Info

  • Alternative names
    • Bladder cancer related protein XHL
    • T box 3
    • T-box protein 3
    • T-box transcription factor TBX3
    • Tbx3
    • TBX3 ISO
    • TBX3_HUMAN
    • UMS
    • XHL
    see all
  • Function
    Transcriptional repressor involved in developmental processes. Probably plays a role in limb pattern formation.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in TBX3 are the cause of ulnar-mammary syndrome (UMS) [MIM:181450]. UMS is characterized by ulnar ray defects, obesity, hypogenitalism, delayed puberty, hypoplasia of nipples and apocrine glands.
  • Sequence similarities
    Contains 1 T-box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114501 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up