Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLG EGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQ YHSVHGVGMVPEWSDNS
    • Molecular weight
      39 kDa including tags
    • Amino acids
      402 to 518

Specifications

Our Abpromise guarantee covers the use of ab114432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Holt Oram syndrome
    • HOS
    • T box 5
    • T box protein 5
    • T box transcription factor TBX 5
    • T box transcription factor TBX5
    • T-box protein 5
    • T-box transcription factor TBX5
    • TBX 5
    • TBX5
    • TBX5_HUMAN
    • Transcription factor T box 5
    see all
  • Function
    Involved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation.
  • Involvement in disease
    Defects in TBX5 are the cause of Holt-Oram syndrome (HOS) [MIM:142900]. HOS is a developmental disorder affecting the heart and upper limbs. It is characterized by thumb anomaly and atrial septal defects.
  • Sequence similarities
    Contains 1 T-box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114432 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up