Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ99593
    • SpeciesHuman
    • SequencePSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLG EGMFQHQTSVAHQPVVRQCGPQTGLQSPGTLQPPEFLYSHGVPRTLSPHQ YHSVHGVGMVPEWSDNS
    • Molecular weight39 kDa including tags
    • Amino acids402 to 518

Specifications

Our Abpromise guarantee covers the use of ab114432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Holt Oram syndrome
    • HOS
    • T box 5
    • T box protein 5
    • T box transcription factor TBX 5
    • T box transcription factor TBX5
    • T-box protein 5
    • T-box transcription factor TBX5
    • TBX 5
    • TBX5
    • TBX5_HUMAN
    • Transcription factor T box 5
    see all
  • FunctionInvolved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation.
  • Involvement in diseaseDefects in TBX5 are the cause of Holt-Oram syndrome (HOS) [MIM:142900]. HOS is a developmental disorder affecting the heart and upper limbs. It is characterized by thumb anomaly and atrial septal defects.
  • Sequence similaritiesContains 1 T-box DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TBX5 protein images

  • ab114432 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human TBX5 protein (ab114432)

ab114432 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"