Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ELKEYAPNVPFLLIGTQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEI GACCYVECSALTQKGLKTVFDEAIIAILTPKKHTVKKRIGSRCINCCLI
    • Amino acids
      106 to 204
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARHQ
    • Ras homolog gene family member Q
    • RAS like family 7 member A
    • Ras like protein family member 7A
    • Ras like protein TC10
    • Ras related GTP binding protein TC10
    • Ras-like protein family member 7A
    • Ras-like protein TC10
    • RASL7A
    • Rho related GTP binding protein RhoQ
    • Rho-related GTP-binding protein RhoQ
    • Rhoq
    • RHOQ_HUMAN
    • TC10A
    see all
  • Function
    Plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses. Involved in epithelial cell polarization processes. May play a role in CFTR trafficking to the plasma membrane. Causes the formation of thin, actin-rich surface projections called filopodia.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rho family.
  • Post-translational
    modifications
    May be post-translationally modified by both palmitoylation and polyisoprenylation.
  • Cellular localization
    Cytoplasm. Cell membrane.
  • Information by UniProt

Images

  • ab161642 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up