Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSF PRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEI RNTDM
    • Molecular weight
      37 kDa including tags
    • Amino acids
      81 to 185

Specifications

Our Abpromise guarantee covers the use of ab116766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GTF2S
    • SII
    • TCEA
    • Tcea1
    • TCEA1_HUMAN
    • TF2S
    • TFIIS
    • Transcription elongation factor A (SII) 1
    • Transcription elongation factor A protein 1
    • Transcription elongation factor A, 1
    • Transcription elongation factor S-II protein 1
    • Transcription elongation factor TFIIS.o
    see all
  • Function
    Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
  • Involvement in disease
    Note=A chromosomal aberration involving TCEA1 may be a cause of salivary gland pleiomorphic adenomas (PA) [181030]. Pleiomorphic adenomas are the most common benign epithelial tumors of the salivary gland. Translocation t(3;8)(p21;q12) with PLAG1.
  • Sequence similarities
    Belongs to the TFS-II family.
    Contains 1 TFIIS central domain.
    Contains 1 TFIIS N-terminal domain.
    Contains 1 TFIIS-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116766 at approximately 37.18kDa; stained with Coomassie Blue.

References

ab116766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up