Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      STEKDLDEKKKEPAITSQNSPEAREESTSSGNVSNRKDETNARDTYVSSF PRAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEI RNTDM
    • Molecular weight
      37 kDa including tags
    • Amino acids
      81 to 185

Specifications

Our Abpromise guarantee covers the use of ab116766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GTF2S
    • SII
    • TCEA
    • Tcea1
    • TCEA1_HUMAN
    • TF2S
    • TFIIS
    • Transcription elongation factor A (SII) 1
    • Transcription elongation factor A protein 1
    • Transcription elongation factor A, 1
    • Transcription elongation factor S-II protein 1
    • Transcription elongation factor TFIIS.o
    see all
  • Function
    Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
  • Involvement in disease
    Note=A chromosomal aberration involving TCEA1 may be a cause of salivary gland pleiomorphic adenomas (PA) [181030]. Pleiomorphic adenomas are the most common benign epithelial tumors of the salivary gland. Translocation t(3;8)(p21;q12) with PLAG1.
  • Sequence similarities
    Belongs to the TFS-II family.
    Contains 1 TFIIS central domain.
    Contains 1 TFIIS N-terminal domain.
    Contains 1 TFIIS-type zinc finger.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human TCEA1 protein images

  • 12.5% SDS-PAGE showing ab116766 at approximately 37.18kDa; stained with Coomassie Blue.

References for Recombinant Human TCEA1 protein (ab116766)

ab116766 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up