Recombinant Human TCEAL1 protein (ab108377)

Overview

  • Product nameRecombinant Human TCEAL1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15170-2
    • SpeciesHuman
    • SequenceMDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFP EELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEG SFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWK AKRSRPYPILEHHHHHH
    • Molecular weight20 kDa including tags
    • Amino acids1 to 159
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab108377 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Highly similar to gene pp21 protein [H.sapiens]
    • Nuclear phosphoprotein p21/SIIR
    • p21
    • pp21
    • SIIR
    • TCAL1_HUMAN
    • TCEA like protein 1
    • TCEA-like protein 1
    • TCEAL1
    • Transcription elongation factor A (SII) like 1
    • Transcription elongation factor A protein like 1
    • Transcription elongation factor A protein-like 1
    • Transcription elongation factor S II protein like 1
    • Transcription elongation factor S-II protein-like 1
    see all
  • FunctionMay be involved in transcriptional regulation. Modulates various viral and cellular promoters in a promoter context-dependent manner. For example, transcription from the FOS promoter is increased, while Rous sarcoma virus (RSV) long terminal repeat (LTR) promoter activity is repressed. Does not bind DNA directly.
  • Tissue specificityExpressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several cancer cell lines.
  • Sequence similaritiesBelongs to the TFS-II family. TFA subfamily.
  • Post-translational
    modifications
    Phosphorylation of Ser-36 and Ser-37 is critical for transcriptional repression.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TCEAL1 protein images

  • 15% SDS-PAGE analysis of ab108377 (3µg)

References for Recombinant Human TCEAL1 protein (ab108377)

ab108377 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"