Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15369
    • SpeciesHuman
    • SequenceMDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPG QFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIA LELLMAANFLDC
    • Molecular weight38 kDa including tags
    • Amino acids1 to 112

Specifications

Our Abpromise guarantee covers the use of ab114949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Elo C
    • EloC
    • ELOC_HUMAN
    • Elongin 15 kDa subunit
    • Elongin C
    • Elongin-C
    • ElonginC
    • RNA polymerase II transcription factor SIII subunit C
    • SIII
    • SIII p15
    • TCEB 1
    • tceb1
    • Transcription elongation factor B (SIII) polypeptide 1
    • Transcription elongation factor B polypeptide 1
    see all
  • FunctionSIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
    The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.
  • Tissue specificityOverexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
  • Sequence similaritiesBelongs to the SKP1 family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TCEB1 protein images

  • 12.5% SDS-PAGE showing ab114949 at approximately 38.06kDa.
    Stained with Coomassie Blue.

References for Recombinant Human TCEB1 protein (ab114949)

ab114949 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"