Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15369
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDGEEKTYGGCEGPDAMYVKLISSDGHEFI VKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYK VRYTNSSTEIPEFPIAPEIALELLMAANFLDC
    • Molecular weight15 kDa including tags
    • Amino acids1 to 112
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab116195 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • Elo C
    • EloC
    • ELOC_HUMAN
    • Elongin 15 kDa subunit
    • Elongin C
    • Elongin-C
    • ElonginC
    • RNA polymerase II transcription factor SIII subunit C
    • SIII
    • SIII p15
    • TCEB 1
    • tceb1
    • Transcription elongation factor B (SIII) polypeptide 1
    • Transcription elongation factor B polypeptide 1
    see all
  • FunctionSIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
    The elongin BC complex seems to be involved as an adapter protein in the proteasomal degradation of target proteins via different E3 ubiquitin ligase complexes, including the von Hippel-Lindau ubiquitination complex CBC(VHL). By binding to BC-box motifs it seems to link target recruitment subunits, like VHL and members of the SOCS box family, to Cullin/RBX1 modules that activate E2 ubiquitination enzymes.
  • Tissue specificityOverexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3.
  • Sequence similaritiesBelongs to the SKP1 family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TCEB1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab116195.

References for Recombinant Human TCEB1 protein (ab116195)

ab116195 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"