Recombinant Human TCF3 / E2A protein (ab114447)

Overview

  • Product nameRecombinant Human TCF3 / E2A protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP15923
    • SpeciesHuman
    • SequenceEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQ AVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGL SEAHNPAGHM
    • Molecular weight38 kDa including tags
    • Amino acids545 to 654

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGM8
    • bHLHb21
    • Class B basic helix-loop-helix protein 21
    • E12
    • E2A
    • E2A immunoglobulin enhancer binding factors E12/E47
    • E47
    • Helix loop helix protein HE47
    • Immunoglobulin enhancer-binding factor E12/E47
    • Immunoglobulin transcription factor 1
    • ITF1
    • Kappa-E2-binding factor
    • MGC129647
    • MGC129648
    • Negative vitamin D response element binding protein
    • NOL1-TCF3 fusion
    • TCF-3
    • Tcf3
    • TFE2_HUMAN
    • Transcription factor 3
    • transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
    • transcription factor 3 variant 3
    • Transcription factor E2-alpha
    • Transcription factor ITF-1
    • VDIR
    • VDR interacting repressor
    • vitamin D receptor-interacting repressor
    see all
  • FunctionHeterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer.
  • Involvement in diseaseNote=Chromosomal aberrations involving TCF3 are cause of forms of pre-B-cell acute lymphoblastic leukemia (B-ALL). Translocation t(1;19)(q23;p13.3) with PBX1; Translocation t(17;19)(q22;p13.3) with HLF. Inversion inv(19)(p13;q13) with TFPT.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Domainthe 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Post-translational
    modifications
    Phosphorylated following NGF stimulation.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TCF3 / E2A protein images

  • ab114447 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human TCF3 / E2A protein (ab114447)

ab114447 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"