Recombinant Human TCF3 / E2A protein (ab114447)

Overview

  • Product name
    Recombinant Human TCF3 / E2A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQ AVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGL SEAHNPAGHM
    • Molecular weight
      38 kDa including tags
    • Amino acids
      545 to 654

Specifications

Our Abpromise guarantee covers the use of ab114447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGM8
    • bHLHb21
    • Class B basic helix-loop-helix protein 21
    • E12
    • E2A
    • E2A immunoglobulin enhancer binding factors E12/E47
    • E47
    • Helix loop helix protein HE47
    • Immunoglobulin enhancer-binding factor E12/E47
    • Immunoglobulin transcription factor 1
    • ITF1
    • Kappa-E2-binding factor
    • MGC129647
    • MGC129648
    • Negative vitamin D response element binding protein
    • NOL1-TCF3 fusion
    • TCF-3
    • Tcf3
    • TFE2_HUMAN
    • Transcription factor 3
    • transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
    • transcription factor 3 variant 3
    • Transcription factor E2-alpha
    • Transcription factor ITF-1
    • VDIR
    • VDR interacting repressor
    • vitamin D receptor-interacting repressor
    see all
  • Function
    Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major roles in determining tissue-specific cell fate during embryogenesis, like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. Binds to the kappa-E2 site in the kappa immunoglobulin gene enhancer.
  • Involvement in disease
    Note=Chromosomal aberrations involving TCF3 are cause of forms of pre-B-cell acute lymphoblastic leukemia (B-ALL). Translocation t(1;19)(q23;p13.3) with PBX1; Translocation t(17;19)(q22;p13.3) with HLF. Inversion inv(19)(p13;q13) with TFPT.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain
    the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Post-translational
    modifications
    Phosphorylated following NGF stimulation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114447 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up