Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP15884
    • SpeciesHuman
    • SequenceMHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV EDRSSSGSWGNGGHPSPSRNYGDGTPYDHTTSRDLGSHDNLSPPFVNSRI QSKTERGSYSSYGRESNLQGCHQQSLLGGDMDMGNPGTLSPTKPGSQYYQ YSSNNPRRRPLHSSAMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPG YPSSKPATSTFPSSFFMQDGHHSSDPWSSSSGMNQPGYAGMLGNSSHIPQ SSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA NGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVG SPPSLSAGTAVWSRN
    • Molecular weight66 kDa including tags
    • Amino acids1 to 365
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114441 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHb19
    • Class B basic helix-loop-helix protein 19
    • E2 2
    • Immunoglobulin transcription factor 2
    • ITF 2
    • ITF-2
    • ITF2
    • ITF2_HUMAN
    • MGC149723
    • MGC149724
    • PTHS
    • SEF 2
    • SEF-2
    • SEF2
    • SEF2 1
    • SEF2 1A
    • SEF2 1B
    • SL3 3 enhancer factor 2
    • SL3-3 enhancer factor 2
    • TCF 4
    • TCF-4
    • TCF4
    • Transcription factor 4
    see all
  • FunctionTranscription factor that binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription (By similarity). Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.
  • Tissue specificityExpressed in adult heart, brain, placenta, skeletal muscle and to a lesser extent in the lung. In developing embryonic tissues, expression mostly occurs in the brain.
  • Involvement in diseaseDefects in TCF4 are a cause of Pitt-Hopkins syndrome (PTHS) [MIM:610954]. PTHS is a rare syndromic encephalopathy characterized by severe psychomotor delay, epilepsy, daily bouts of diurnal hyperventilation starting in infancy, mild postnatal growth retardation, postnatal microcephaly, and distinctive facial features. Since most hitherto reported cases have been sporadic, with males and females equally affected, PTHS is regarded as an autosomal dominant condition.
  • Sequence similaritiesContains 1 basic helix-loop-helix (bHLH) domain.
  • Domainthe 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TCF4 protein images

  • ab114441 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human TCF4 protein (ab114441)

ab114441 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114441.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"