Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGW SARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
    • Amino acids
      287 to 384
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ36364
    • MGC47735
    • OTTHUMP00000159391
    • T cell factor 1
    • T cell specific transcription factor 1
    • T-cell factor 1
    • T-cell-specific transcription factor 1
    • TCF-1
    • TCF-7
    • TCF1
    • Tcf7
    • TCF7 transcription factor 7
    • TCF7_HUMAN
    • Transcription factor 7
    • Transcription factor 7 (T cell specific HMG box)
    • Transcription factor-7, T-cell specific
    • Transcription factor-7, T-cell specific, 1
    see all
  • Function
    Transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4(+) CD8(+) immature thymocytes. Isoforms lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. Binds to the T-lymphocyte-specific enhancer element (5'-WWCAAAG-3') found in the promoter of the CD3E gene. May also act as feedback transcriptional repressor of CTNNB1 and TCF7L2 target genes. TLE1, TLE2, TLE3 and TLE4 repress transactivation mediated by TCF7 and CTNNB1.
  • Tissue specificity
    Predominantly in T-cells. Also detected in proliferating intestinal epithelial cells and in the basal epithelial cells of mammary gland epithelium.
  • Sequence similarities
    Belongs to the TCF/LEF family.
    Contains 1 HMG box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159647 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up