Overview

  • Product name
    Recombinant Human TCN1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNR GTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIIL ALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLD VLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKK SLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQA LFVSSDYYNENDWNCRQTLNTVLTEISQGAFSNPNAAAQVLPALMGKTFL DINKDSSCVPASGNFNISADEPITVTPPDSQSYISVDYSVRINETYFTNV AVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRT YWELLSGGEPLSQGAGSYVVRNG
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 424

Specifications

Our Abpromise guarantee covers the use of ab114723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Haptocorin
    • Haptocorrin
    • HC
    • OTTHUMP00000235879
    • TC 1
    • TC I
    • TC-1
    • TC1
    • TCI
    • TCN 1
    • TCN1
    • TCO1_HUMAN
    • Transcobalamin 1
    • Transcobalamin I
    • Transcobalamin-1
    • Transcobalamin1
    • TranscobalaminI
    • Vitamin B12 binding protein
    • Vitamin B12 binding protein R binder family
    see all
  • Function
    Vitamin B12-binding protein. Transports cobalamin into cells.
  • Tissue specificity
    Neutrophil granule protein.
  • Sequence similarities
    Belongs to the eukaryotic cobalamin transport proteins family.
  • Post-translational
    modifications
    Contains about 30% carbohydrates.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up