Overview

  • Product nameRecombinant Human TCN1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20061
    • SpeciesHuman
    • SequenceMRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNR GTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIIL ALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLD VLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKK SLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQA LFVSSDYYNENDWNCRQTLNTVLTEISQGAFSNPNAAAQVLPALMGKTFL DINKDSSCVPASGNFNISADEPITVTPPDSQSYISVDYSVRINETYFTNV AVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRT YWELLSGGEPLSQGAGSYVVRNG
    • Molecular weight72 kDa including tags
    • Amino acids1 to 424

Specifications

Our Abpromise guarantee covers the use of ab114723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Haptocorin
    • Haptocorrin
    • HC
    • OTTHUMP00000235879
    • TC 1
    • TC I
    • TC-1
    • TC1
    • TCI
    • TCN 1
    • TCN1
    • TCO1_HUMAN
    • Transcobalamin 1
    • Transcobalamin I
    • Transcobalamin-1
    • Transcobalamin1
    • TranscobalaminI
    • Vitamin B12 binding protein
    • Vitamin B12 binding protein R binder family
    see all
  • FunctionVitamin B12-binding protein. Transports cobalamin into cells.
  • Tissue specificityNeutrophil granule protein.
  • Sequence similaritiesBelongs to the eukaryotic cobalamin transport proteins family.
  • Post-translational
    modifications
    Contains about 30% carbohydrates.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human TCN1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human TCN1 protein (ab114723)

ab114723 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"