Overview

  • Product name
    Recombinant Human TCN1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLLNTMIQSNYNR GTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIIL ALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLD VLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKK SLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQA LFVSSDYYNENDWNCRQTLNTVLTEISQGAFSNPNAAAQVLPALMGKTFL DINKDSSCVPASGNFNISADEPITVTPPDSQSYISVDYSVRINETYFTNV AVLNGSVFLSVMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRT YWELLSGGEPLSQGAGSYVVRNG
    • Molecular weight
      72 kDa including tags
    • Amino acids
      1 to 424

Specifications

Our Abpromise guarantee covers the use of ab114723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Haptocorin
    • Haptocorrin
    • HC
    • OTTHUMP00000235879
    • TC 1
    • TC I
    • TC-1
    • TC1
    • TCI
    • TCN 1
    • TCN1
    • TCO1_HUMAN
    • Transcobalamin 1
    • Transcobalamin I
    • Transcobalamin-1
    • Transcobalamin1
    • TranscobalaminI
    • Vitamin B12 binding protein
    • Vitamin B12 binding protein R binder family
    see all
  • Function
    Vitamin B12-binding protein. Transports cobalamin into cells.
  • Tissue specificity
    Neutrophil granule protein.
  • Sequence similarities
    Belongs to the eukaryotic cobalamin transport proteins family.
  • Post-translational
    modifications
    Contains about 30% carbohydrates.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human TCN1 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human TCN1 protein (ab114723)

ab114723 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up