Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKSGQHLLPWMDRLSLEHL NPSIYVGLRLSSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKP SMGQLALYLLALRANWHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVD KLLYAVEPFHQGHHSVDTAAMAGLAFTCLKRSNFNPGRRQRITMAIRTVR EEILKAQTPEGHFGNVYSTPLALQFLMTSPMRGAELGTACLKARVALLAS LQDGAFQNALMISQLLPVLNHKTYIDLIFPDCLAPRVMLEPAAETIPQTQ EIISVTLQVLSLLPPYRQSISVLAGSTVEDVLKKAHELGGFTYETQASLS GPYLTSVMGKAAGEREFWQLLRDPNTPLLQGIADYRPKDGETIELRLVSW
    • Amino acids
      1 to 400
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D22S676
    • D22S750
    • II
    • Macrocytic anemia
    • OTTHUMP00000199117
    • OTTHUMP00000199118
    • OTTHUMP00000199119
    • TC
    • TC II
    • TC II deficiency
    • TC-2
    • TC2
    • TCII
    • TCN2
    • TCN2 deficiency
    • TCO2_HUMAN
    • Transcobalamin 2
    • Transcobalamin 2 deficiency
    • Transcobalamin II
    • Transcobalamin II; macrocytic anemia
    • Transcobalamin-2
    • Vitamin B12 binding protein 2
    see all
  • Function
    Primary vitamin B12-binding and transport protein. Delivers cobalamin to cells.
  • Involvement in disease
    Defects in TCN2 are the cause of transcobalamin II deficiency (TCN2 deficiency) [MIM:275350]. This results in various forms of anemia.
  • Sequence similarities
    Belongs to the eukaryotic cobalamin transport proteins family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159656 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up