Recombinant Human TCP1 alpha protein (ab101043)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEGPLSVFGDRSTGETIRSQNVMAAASIAN IVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAD LQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVR YINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIK YTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIV NAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILA TGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILST LANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGA NDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSM GSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPER KNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDL IKLHPESKDD KHGSYEDAVHSGALND
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 576
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • AI528772
    • c-cpn
    • CCT
    • CCT alpha
    • CCT-alpha
    • CCT1
    • Ccta
    • CCTalpha
    • D6S230E
    • MGC133746
    • p63
    • T complex 1
    • T complex protein 1
    • T complex protein 1 alpha subunit
    • T-complex homolog TCP1
    • T-complex protein 1 subunit alpha
    • T-complex protein 1 subunit alpha B
    • Tailless complex polypeptide 1
    • Tailless complex polypeptide 1A
    • Tailless complex polypeptide 1B
    • TCP 1 alpha
    • Tcp-1
    • TCP-1-alpha
    • TCP1
    • TCPA_HUMAN
    • Tp63
    • TRic
    see all
  • Function
    Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.
  • Sequence similarities
    Belongs to the TCP-1 chaperonin family.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Images

  • ab101043 at 3 µg being analysed by 15% SDS-PAGE.

References

ab101043 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up