Recombinant Human TCP1 alpha protein (ab101043)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEGPLSVFGDRSTGETIRSQNVMAAASIAN IVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAD LQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVR YINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIK YTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIV NAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILA TGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILST LANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASIILRGA NDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSM GSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPER KNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDL IKLHPESKDD KHGSYEDAVHSGALND
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 576
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 80 % SDS-PAGE.
    purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • AI528772
    • c-cpn
    • CCT
    • CCT alpha
    • CCT-alpha
    • CCT1
    • Ccta
    • CCTalpha
    • D6S230E
    • MGC133746
    • p63
    • T complex 1
    • T complex protein 1
    • T complex protein 1 alpha subunit
    • T-complex homolog TCP1
    • T-complex protein 1 subunit alpha
    • T-complex protein 1 subunit alpha B
    • Tailless complex polypeptide 1
    • Tailless complex polypeptide 1A
    • Tailless complex polypeptide 1B
    • TCP 1 alpha
    • Tcp-1
    • TCP-1-alpha
    • TCP1
    • TCPA_HUMAN
    • Tp63
    • TRic
    see all
  • Function
    Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.
  • Sequence similarities
    Belongs to the TCP-1 chaperonin family.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > centrosome.
  • Information by UniProt

Recombinant Human TCP1 alpha protein images

  • ab101043 at 3 µg being analysed by 15% SDS-PAGE.

References for Recombinant Human TCP1 alpha protein (ab101043)

ab101043 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up