Recombinant Human TCP1 eta protein (ab161052)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTW YGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPR STVD
    • Amino acids
      425 to 528
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCT ETA
    • CCT-eta
    • CCT7
    • CCTETA
    • Ccth
    • Chaperonin containing t complex polypeptide 1 eta subunit
    • Chaperonin containing TCP1 subunit 7
    • Chaperonin containing TCP1 subunit 7 (eta)
    • HIV 1 Nef interacting protein
    • HIV-1 Nef-interacting protein
    • Nip7 1
    • T complex protein 1 eta subunit
    • T-complex protein 1 subunit eta, N-terminally processed
    • TCP-1-eta
    • TCP1eta
    • TCPH_HUMAN
    see all
  • Function
    Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. Known to play a role, in vitro, in the folding of actin and tubulin.
  • Sequence similarities
    Belongs to the TCP-1 chaperonin family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab161052 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up