Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ8WWU5-2
    • SpeciesHuman
    • SequenceNTASLMGQLQNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGL TLIEAELAELGQKFVNLTHHNQQVFGPYYTEILKTLISPAQALETKVESV
    • Molecular weight37 kDa including tags
    • Amino acids342 to 441

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D6S230E
    • KIAA0229
    • MGC111103
    • T complex 11
    • T complex 11 (a murine tcp homolog)
    • T complex 11 homolog (mouse)
    • T complex protein 11 homolog
    • T-complex protein 11 homolog
    • Tcp11
    • TCP11_HUMAN
    see all
  • FunctionMay play an important role in sperm function and fertility.
  • Tissue specificityExpressed only in fertile adult testis.
  • Sequence similaritiesBelongs to the TCP11 family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human TCP11 protein images

  • 12.5% SDS-PAGE showing ab116954 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human TCP11 protein (ab116954)

ab116954 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"