Recombinant Human TCR alpha protein (ab112359)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      NIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVL DMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLV
    • Molecular weight
      37 kDa including tags
    • Amino acids
      133 to 232

Specifications

Our Abpromise guarantee covers the use of ab112359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • T cell antigen receptor alpha polypeptide
    • T cell receptor alpha
    • T cell receptor alpha locus
    • T-cell receptor alpha chain C region
    • TCRA
    • TCRD
    • TRA
    • TRA@
    • TRAC
    see all
  • Relevance
    TCR (T cell antigen receptor) recognizes foreign antigens and translates such recognition events into intracellular signals that elicit a change in the cell from a dormant to an activated state. TCR is a heterodimer composed of either alpha and beta or gamma and delta chains. CD3 chains and the CD4 or CD8 coreceptors are also required for efficient signal transduction through the TCR.
  • Cellular localization
    Plasma membrane

Images

  • ab112359 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up