Recombinant Human TCR V delta 1 protein (ab159659)

Overview

  • Product name
    Recombinant Human TCR V delta 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVTCSVQHDNKTVHST DFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR
    • Amino acids
      173 to 272
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • T cell antigen receptor delta polypeptide
    • T cell receptor delta (V,D,J,C)
    • T cell receptor delta locus
    • TCRD
    • TCRDV1
    • TRA@ protein
    • TRD
    • TRD@
    see all
  • Relevance
    Two distinct types of T cell antigen receptors have been identified: the alpha/beta heterodimer found on functional helper and cytotoxic T cells, and the gamma/delta heterodimer. The latter is first detected approximately 2 days before the appearance of cell surface alpha/beta heterodimer during T cell ontogeny. In adult thymus it is found mainly in the least mature cells. The gene shows systematic rearrangement in early thymocytes and appears to use V gene segments of the TCR alpha chain family, well before any C(alpha) message of protein is detected. RNA from this locus is expressed at a high level in early thymocytes and adult 'double-negative' cells, but not in mature T cell populations.

Images

  • ab159659 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up