Overview

  • Product name
    Recombinant Human TCTA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSL LGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKT HRE
    • Amino acids
      1 to 103
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159661 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • T-cell leukemia translocation altered gene
    • T-cell leukemia translocation-altered gene protein
    • T-cell leukemia translocation-associated gene protein
    • Tcta
    • TCTA_HUMAN
    see all
  • Function
    May be required for cellular fusion during osteoclastogenesis.
  • Tissue specificity
    Ubiquitous. Highest level of expression in kidney. Present in monocytes, osteoclasts, macrophages, synoviocytes and synovial lining cells (at protein level).
  • Involvement in disease
    A chromosomal aberration involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(1;3)(p34;p21).
  • Sequence similarities
    Belongs to the TCTA family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159661 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159661 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159661.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up