Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP48775
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSGCPFLGNNFGYTFKKLPVEGSEEDKSQT GVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYE LWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFS ILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNI TRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKG ERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVC MVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPK MNPTIHKFLYTAEYCDSSYFSSDESD)
    • Molecular weight50 kDa including tags
    • Amino acids1 to 406
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Purity> 90 % SDS-PAGE.
    ab104463 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0

General Info

  • Alternative names
    • 3-dioxygenase
    • T23O_HUMAN
    • TDO
    • TDO 2
    • tdo2
    • TO
    • TPH2
    • TRPO
    • Tryptamin 2
    • Tryptamin 2 3 dioxygenase
    • Tryptophan 2
    • Tryptophan 2 3 dioxygenase
    • Tryptophan oxygenase
    • Tryptophan pyrrolase
    • Tryptophanase
    see all
  • FunctionIncorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin.
  • PathwayAmino-acid degradation; L-tryptophan degradation via kynurenine pathway; L-kynurenine from L-tryptophan: step 1/2.
  • Sequence similaritiesBelongs to the tryptophan 2,3-dioxygenase family.
  • Information by UniProt

Recombinant Human TDO2 protein images

  • 15% SDS-PAGE showing ab104463 (3 µg) at approximately 50 kDa.

References for Recombinant Human TDO2 protein (ab104463)

ab104463 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"