Overview

  • Product name
    Recombinant Human TdT protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRA FLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPE LLDVSWLIEC
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 110

Specifications

Our Abpromise guarantee covers the use of ab152345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deoxynucleotidyltransferase terminal
    • DNA nucleotidylexotransferase
    • DNTT
    • Nucleosidetriphosphate DNA deoxynucleotidylexotransferase
    • TDT
    • TDT_HUMAN
    • Terminal addition enzyme
    • Terminal deoxynucleotidyltransferase
    • Terminal deoxyribonucleotidyltransferase
    • Terminal transferase
    see all
  • Function
    Template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells.
  • Sequence similarities
    Belongs to the DNA polymerase type-X family.
    Contains 1 BRCT domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152345 stained with Coomassie Blue.

References

ab152345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up