Recombinant Human TEA domain family member 2 protein (ab152874)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIE QSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQV SSHIQVLARRKSREIQSKLKDQVSKDKAFQTMATMSSAQLISAPSLQAKL GPTGPQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYE PPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHL FVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLV KFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSF GKQVVEKVETERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMN SVLENFTILQVVTNRDTQELLLCTAYVFEVSTSERGAQHHIYRLVRD
    • Amino acids
      1 to 447
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152874 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Embryonic TEA domain containing factor
    • Etdf
    • ETEF 1
    • ETF
    • TEA domain family member 2
    • TEAD 2
    • TEAD-2
    • TEAD2
    • Tead2 protein (TEA domain family member 2 (Mapped), isoform CRA_b)
    • TEAD2_HUMAN
    • TEF 4
    • TEF4
    • Transcriptional enhancer factor 4
    • Transcriptional enhancer factor TEF 4
    • Transcriptional enhancer factor TEF-4
    see all
  • Function
    Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3'). May be involved in the gene regulation of neural development. Binds to the M-CAT motif.
  • Sequence similarities
    Contains 1 TEA DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab152874 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152874 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152874.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up