Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLE AVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWAD
    • Amino acids
      215 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DTEF 1
    • DTEF-1
    • DTEF1
    • ETFR 1
    • ETFR1
    • TEA domain family member 3
    • TEA domain family member 5
    • TEAD 3
    • TEAD-3
    • Tead3
    • TEAD3_HUMAN
    • TEAD5
    • TEF 5
    • TEF5
    • Transcriptional enhancer factor 5
    • Transcriptional enhancer factor TEF 5
    • Transcriptional enhancer factor TEF 5 (DTEF 1)
    • Transcriptional enhancer factor TEF-5
    see all
  • Function
    Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds to multiple functional elements of the human chorionic somatomammotropin-B gene enhancer.
  • Tissue specificity
    Preferentially expressed in the placenta.
  • Sequence similarities
    Contains 1 TEA DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159664 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up