Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAK DKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGT SHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSK LWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDK FPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESP ENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINF IHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHG AQHHIYRLVKE
    • Molecular weight
      65 kDa including tags
    • Amino acids
      74 to 434

Specifications

Our Abpromise guarantee covers the use of ab152733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EFTR 2
    • EFTR2
    • hRTEF 1B
    • hRTEF1B
    • MGC9014
    • OTTHUMP00000238119
    • OTTHUMP00000238122
    • OTTHUMP00000238124
    • Related to TEF 1
    • Related to TEF1
    • Related transcription enhancer factor 1B
    • RTEF1
    • TCF13L1
    • TEA domain family member 4
    • TEAD 4
    • TEAD-4
    • TEAD4
    • TEAD4_HUMAN
    • TEF 3
    • TEF3
    • TEFR 1
    • TEFR1
    • Transcription factor 13 (SV40 transcriptional enhancer factor) like 1
    • Transcription factor 13 like 1
    • Transcription factor 13-like 1
    • Transcription factor RTEF 1
    • Transcription factor RTEF-1
    • Transcription factor RTEF1
    • Transcriptional enhancer factor 1 related
    • Transcriptional enhancer factor 3
    • Transcriptional enhancer factor TEF 3
    • Transcriptional enhancer factor TEF-3
    • Transcriptional enhancer factor TEF3
    see all
  • Function
    Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.
  • Tissue specificity
    Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.
  • Sequence similarities
    Contains 1 TEA DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152733 stained with Coomassie Blue.

References

ab152733 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up