Overview

  • Product name
    Recombinant Human TECTA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YATPTRDSNDKLRYFIIEGGCQNLKDNTIGIEENAVSLTCRFHVTVFKFI GDYDEVHLHCAVSLCDSEKYSCKITCPHNSRIATDYTKEPKEQIISVGPI
    • Amino acids
      1981 to 2080
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha-tectorin
    • DFNA12
    • DFNA8
    • DFNB21
    • OTTHUMP00000195078
    • TECTA
    • TECTA_HUMAN
    see all
  • Function
    One of the major non-collagenous components of the tectorial membrane (By similarity). The tectorial membrane is an extracellular matrix of the inner ear that covers the neuroepithelium of the cochlea and contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals.
  • Involvement in disease
    Defects in TECTA are the cause of deafness autosomal dominant type 12 (DFNA12) [MIM:601543]; also known as DFNA8. DFNA12 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
    Defects in TECTA are the cause of deafness autosomal recessive type 21 (DFNB21) [MIM:603629].
  • Sequence similarities
    Contains 1 NIDO domain.
    Contains 3 TIL (trypsin inhibitory-like) domains.
    Contains 1 VWFC domain.
    Contains 4 VWFD domains.
    Contains 1 ZP domain.
  • Domain
    Zona pellucida domain may enable to form filaments.
  • Post-translational
    modifications
    The presence of a hydrophobic C-terminus preceded by a potential cleavage site strongly suggests that tectorins are synthesized as glycosylphosphatidylinositol-linked, membrane-bound precursors. Tectorins are targeted to the apical surface of the inner ear epithelia by the lipid and proteolytically released into the extracellular compartment.
  • Cellular localization
    Cell membrane. Secreted > extracellular space > extracellular matrix. Found in the non-collagenous matrix of the tectorial membrane.
  • Information by UniProt

Images

  • ab159666 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up