Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITI RAAFLEKENTALRTEVAELRKEVGKCKTIVSKYETKYGPL
    • Amino acids
      214 to 303
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310028D20Rik
    • fb11h02
    • MGC64507
    • Tef
    • TEF_HUMAN
    • tefa
    • tefb
    • tefbeta
    • Thyrotroph embryonic factor
    • VBP
    • Vitellogenin gene binding protein
    • wu:fa12f02
    • wu:fb11h02
    • zTEF[a]
    see all
  • Function
    Transcription factor that binds to and transactivates the TSHB promoter. Binds to a minimal DNA-binding sequence 5'-[TC][AG][AG]TTA[TC][AG]-3'.
  • Sequence similarities
    Belongs to the bZIP family. PAR subfamily.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159668 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up