Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETN NQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA
    • Amino acids
      1 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • TEKT2
    • TEKT2_HUMAN
    • TEKTB1
    • Tektin 2
    • Tektin B1
    • Tektin t
    • Tektin-2
    • Tektin-B1
    • Tektin-t
    • Testicular tektin
    • Testicular tektin B1 like protein
    • Testicular tektin B1-like protein
    see all
  • Function
    Structural component of ciliary and flagellar microtubules. Plays a key role in the assembly or attachment of the inner dynein arm to microtubules in sperm flagella and tracheal cilia. Forms filamentous polymers in the walls of ciliary and flagellar microtubules.
  • Tissue specificity
    Expressed at high levels in testis, trachea and fetal lung, and at lower levels in ovary, pituitary, adult lung, fetal brain and fetal kidney.
  • Sequence similarities
    Belongs to the tektin family.
  • Post-translational
    modifications
    Tyrosine phosphorylated.
  • Cellular localization
    Cell projection > cilium > flagellum. Cytoplasm > cytoskeleton > cilium axoneme. Cytoplasm > cytoskeleton > flagellum axoneme. In sperm, observed in a discontinuous punctate pattern in the flagellum and in the postacrosomal head region.
  • Information by UniProt

Images

  • ab162132 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up