Overview

  • Product name
    Recombinant Human Testin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDLENKVKKMGLGHEQGFGAPCLKCKEKCE GFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLK SDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQML PKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVK KYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHK RTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIY FWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFD CDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNF SWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
    • Molecular weight
      50 kDa including tags
    • Amino acids
      1 to 421
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99213 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • DKFZP586B2022
    • MGC1146
    • TES
    • TES_HUMAN
    • TESS
    • TESS 2
    • TESS2
    • Testin
    • Testis derived transcript
    • Testis derived transcript (3 LIM domains)
    see all
  • Function
    Scaffold protein that may play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Plays a role in the regulation of cell proliferation. May act as a tumor suppressor. Inhibits tumor cell growth.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the prickle / espinas / testin family.
    Contains 3 LIM zinc-binding domains.
    Contains 1 PET domain.
  • Domain
    The N-terminal and the C-terminal halves of the protein can associate with each other, thereby hindering interactions with ZYX.
  • Cellular localization
    Cytoplasm. Cell junction > focal adhesion. Detected along actin stress fibers.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab99213.

References

ab99213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up