Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UGI8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDLENKVKKMGLGHEQGFGAPCLKCKEKCE GFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLK SDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQML PKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVK KYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHK RTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIY FWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFD CDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNF SWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
    • Molecular weight50 kDa including tags
    • Amino acids1 to 421
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99213 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • DKFZP586B2022
    • MGC1146
    • TES
    • TES_HUMAN
    • TESS
    • TESS 2
    • TESS2
    • Testin
    • Testis derived transcript
    • Testis derived transcript (3 LIM domains)
    see all
  • FunctionScaffold protein that may play a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. Plays a role in the regulation of cell proliferation. May act as a tumor suppressor. Inhibits tumor cell growth.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the prickle / espinas / testin family.
    Contains 3 LIM zinc-binding domains.
    Contains 1 PET domain.
  • DomainThe N-terminal and the C-terminal halves of the protein can associate with each other, thereby hindering interactions with ZYX.
  • Cellular localizationCytoplasm. Cell junction > focal adhesion. Detected along actin stress fibers.
  • Information by UniProt

Recombinant Human Testin protein images

  • 15% SDS-PAGE analysis of 3µg ab99213.

References for Recombinant Human Testin protein (ab99213)

ab99213 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"