Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEERYGEKGKAIRIEKVIYTGKEGKSSRGCPIAKWVIRRHTLEEKLLCLV RHRAGHHCQNAVIVILILAWEGIPRSLGDTLYQELTDTLRKYGNPTSRRC GLNDDRTCACQGKDPNTCGASFSFGCSWSMYFNGCKYARSKTPRKFRLAG DNPKEEEVLRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLK EGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPEDE QLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKS CRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAGITSDPGLSLKGG LSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVY SYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGH SGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQ PAYPGPKEYLLPKAPLLHSVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAE PVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGV FSSGESPAIVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRL RGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKLWN PMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSL EEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDENIGGVAVAP AHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLAL WEAKMKQLAERARARQEEAARLGLGQQEAKLYGKKRKWGGTVVAEPQQKE KKGVVPTRQALAVPTDSAVTVSSYAYTKVTGPYSRWI
    • Amino acids
      1 to 937
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hCG_40738
    • KIAA0401
    • Methylcytosine dioxygenase TET3
    • Probable methylcytosine dioxygenase TET3
    • Tet methylcytosine dioxygenase 3
    • Tet oncogene family member 3
    • Tet3
    • TET3_HUMAN
    see all
  • Function
    Catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC).
  • Tissue specificity
    Expressed in colon, muscle, adrenal gland and peripheral blood lymphocytes.
  • Sequence similarities
    Belongs to the TET family.
  • Developmental stage
    Expressed in fetal brain but not adult brain.
  • Information by UniProt

Images

  • ab153625 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up