Overview

  • Product nameRecombinant Human TFB1M protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8WVM0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMQAAKQLSQNFLLDLRLTDKIVRKAGNLTN AYVYEVGPGPGGITRSIL NADVAELLVVEKDTRFIPGLQMLSDAAPGK LRIVHGDVLTFKVEKAFSESLKRPWEDDPPNVHIIGNLPFSVSTP LII KWLENISCRDGPFVYGRTQMTLTFQKEVAERLAANTGSKQRSRLSVMAQY LCNVRHIFTIPGQAFVPKPEVD VGVVHFTPLIQPKIEQPFKLVEKVVQ NVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISH FKSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYRL
    • Molecular weight39 kDa including tags
    • Amino acids28 to 346
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113141 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • CGI75
    • Dimethyladenosine transferase 1, mitochondrial
    • h-mtTFB
    • h-mtTFB1
    • hmtTFB
    • hmtTFB1
    • hTFB1M
    • Mitochondrial 12S rRNA dimethylase 1
    • Mitochondrial dimethyladenosine transferase 1
    • Mitochondrial transcription factor B1
    • mtTFB1
    • N'-adenosyl(rRNA) dimethyltransferase 1
    • S-adenosylmethionine-6-N'
    • Tfb1m
    • TFB1M_HUMAN
    • Transcription factor B1 mitochondrial
    see all
  • FunctionS-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity.
  • Tissue specificityUbiquitously expressed.
  • Involvement in diseaseNote=Variations in TFB1M may influence the clinical expression of aminoglycoside-induced deafness caused by the A1555G mutation in the mitochondrial 12S rRNA.
  • Sequence similaritiesBelongs to the methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family. KsgA subfamily.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human TFB1M protein images

  • 15% SDS-PAGE analysis of ab113141 (3µg)

References for Recombinant Human TFB1M protein (ab113141)

ab113141 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"