Overview

  • Product name
    Recombinant Human TFDP3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPQRPAASNIPVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMG LCRLSMKVWETVQRKGTTSCQEVVGELVAKFRAASNHASPNESAYDVKNI
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 30
    • CT30
    • DP4
    • E2F like protein
    • E2F-like
    • HCA661
    • Hepatocellular carcinoma-associated antigen 661
    • TFDP3
    • TFDP3_HUMAN
    • Transcription factor Dp family member 3
    see all
  • Function
    Competitive inhibitor of E2F-mediated transactivation activity. Impairs E2F-mediated cell-cycle progression from G(1) to S phase.
  • Tissue specificity
    Predominantly expressed in testis. Low level of expression in pancreas. Highly expressed in ovarian and colon cancer cell lines.
  • Sequence similarities
    Belongs to the E2F/DP family.
  • Domain
    The potential DNA-binding domain differs in sequence from that of other DP family members and can not bind DNA.
  • Cellular localization
    Nucleus. Cytoplasm. Translocates to the nucleus on heterodimerization with E2F family members.
  • Information by UniProt

Images

  • ab162482 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up