Recombinant Human TFII I protein (ab114787)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP78347
    • SpeciesHuman
    • SequenceMAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVY ETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQAN RMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVV QGLPEGVAFKHPENYDLATLKWILENKAGVSFIIKRPFLEPKKHVGGRVM VTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQ YNIQGSHHSSEGNEGTEMEVPAEG
    • Molecular weight56 kDa including tags
    • Amino acids1 to 274

Specifications

Our Abpromise guarantee covers the use of ab114787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BAP 135
    • BAP-135
    • BAP135
    • Bruton tyrosine kinase associated protein 135
    • Bruton tyrosine kinase-associated protein 135
    • BTK associated protein
    • BTK associated protein 135
    • BTK associated protein 135kD
    • BTK-associated protein 135
    • BTKAP 1
    • BTKAP1
    • DIWS
    • FLJ38776
    • FLJ56355
    • General transcription factor II i
    • General transcription factor II-I
    • General transcription factor IIi
    • GTF 2I
    • Gtf2i
    • GTF2I_HUMAN
    • GTFII I
    • GTFII-I
    • IB 291
    • IB291
    • SPIN
    • SRF Phox 1 interacting protein
    • SRF Phox1 interacting protein
    • SRF-Phox1-interacting protein
    • TFII-I
    • Transcription factor II I
    • WBS
    • WBSCR 6
    • WBSCR6
    • Williams Beuren syndrome chromosome region 6
    • Williams Beuren syndrome chromosome region 6 protein
    • Williams-Beuren syndrome chromosomal region 6 protein
    see all
  • FunctionInteracts with the basal transcription machinery by coordinating the formation of a multiprotein complex at the C-FOS promoter, and linking specific signal responsive activator complexes. Promotes the formation of stable high-order complexes of SRF and PHOX1 and interacts cooperatively with PHOX1 to promote serum-inducible transcription of a reporter gene deriven by the C-FOS serum response element (SRE). Acts as a coregulator for USF1 by binding independently two promoter elements, a pyrimidine-rich initiator (Inr) and an upstream E-box. Required for the formation of functional ARID3A DNA-binding complexes and for activation of immunoglobulin heavy-chain transcription upon B-lymphocyte activation.
  • Tissue specificityUbiquitous. Isoform 1 is strongly expressed in fetal brain, weakly in adult brain, muscle, and lymphoblasts and is almost undetectable in other adult tissues, while the other isoforms are equally expressed in all adult tissues.
  • Involvement in diseaseNote=GTF2I is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of GTF2I may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similaritiesBelongs to the TFII-I family.
    Contains 6 GTF2I-like repeats.
  • Post-translational
    modifications
    Transiently phosphorylated on tyrosine residues by BTK in response to B-cell receptor stimulation. Phosphorylation on Tyr-248 and Tyr-398, and perhaps, on Tyr-503 contributes to BTK-mediated transcriptional activation.
    Sumoylated.
  • Cellular localizationCytoplasm. Nucleus. Colocalizes with BTK in the cytoplasm.
  • Information by UniProt

Recombinant Human TFII I protein images

  • ab114787 on 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human TFII I protein (ab114787)

ab114787 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. The antibody ab63344 detects TFII I when phosphorylated at tyrosine 248. We do not have a phosphorylated TFII I protein. We do have a ab114787, which is a non-phosphorylated fragment of TFII I, amino acids 1-274, bu...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"