Overview

  • Product name
    Recombinant Human TFIIS protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMMGKEEEIARIARRLDKMVTKKSAEGA MDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAKSLIKSWK KLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITT FPPVPVTCDAVRNKCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRD VGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLCGAITPQQIAVMTSEEMA SDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTR SSDEPMTTFVVCNECGNRWKFC
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 299
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab156967 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 1.45% Sodium chloride

General Info

  • Alternative names
    • Tcea2
    • TCEA2_HUMAN
    • Testis specific S II
    • Testis-specific S-II
    • TFIIS
    • Transcription elongation factor A (SII) 2
    • Transcription elongation factor A 2
    • Transcription elongation factor A protein 2
    • Transcription elongation factor S II protein 2
    • Transcription elongation factor S-II protein 2
    • Transcription elongation factor TFIIS.1
    • Transcription elongation factor TFIIS.l
    see all
  • Function
    Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
  • Tissue specificity
    Testis and ovary specific.
  • Sequence similarities
    Belongs to the TFS-II family.
    Contains 1 TFIIS central domain.
    Contains 1 TFIIS N-terminal domain.
    Contains 1 TFIIS-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156967 (3 µg).

References

ab156967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up