Recombinant Human TFIISH protein (ab117000)

Overview

  • Product name
    Recombinant Human TFIISH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSIQLLQTTRIGV AVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKE KGLECSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSSPKRPSVERSN SSKSKAESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALK ADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRN PGLRRNVLSGAISAGLIAKMTAEEMASDELRELRNAMTQEAIREHQMAKT GGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC
    • Molecular weight
      64 kDa including tags
    • Amino acids
      1 to 348

Specifications

Our Abpromise guarantee covers the use of ab117000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Rhabdomyosarcoma antigen MU RMS 40.22
    • Tcea3
    • TCEA3_HUMAN
    • TFIIS
    • TFIIS.H
    • Transcription elongation factor A (SII) 3
    • Transcription elongation factor A protein 3
    • Transcription elongation factor A3
    • Transcription elongation factor S-II protein 3
    • Transcription elongation factor TFIIS.h
    see all
  • Function
    Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
  • Sequence similarities
    Belongs to the TFS-II family.
    Contains 1 TFIIS central domain.
    Contains 1 TFIIS N-terminal domain.
    Contains 1 TFIIS-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117000 at approx. 64.39 kDa.
    Stained with Coomassie Blue.

References

ab117000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up