Recombinant Human TFIISH protein (ab117000)

Overview

  • Product nameRecombinant Human TFIISH protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75764
    • SpeciesHuman
    • SequenceMGQEEELLRIAKKLEKMVARKNTEGALDLLKKLHSCQMSIQLLQTTRIGV AVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPGPPKGEKGEEREKAKKKE KGLECSDWKPEAGLSPPRKKREDPKTRRDSVDSKSSASSSPKRPSVERSN SSKSKAESPKTPSSPLTPTFASSMCLLAPCYLTGDSVRDKCVEMLSAALK ADDDYKDYGVNCDKMASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRN PGLRRNVLSGAISAGLIAKMTAEEMASDELRELRNAMTQEAIREHQMAKT GGTTTDLFQCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC
    • Molecular weight64 kDa including tags
    • Amino acids1 to 348

Specifications

Our Abpromise guarantee covers the use of ab117000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Tcea3
    • TCEA3_HUMAN
    • TFIIS
    • TFIIS.H
    • Transcription elongation factor A (SII) 3
    • Transcription elongation factor A protein 3
    • Transcription elongation factor S-II protein 3
    • Transcription elongation factor TFIIS.h
    see all
  • FunctionNecessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
  • Sequence similaritiesBelongs to the TFS-II family.
    Contains 1 TFIIS central domain.
    Contains 1 TFIIS N-terminal domain.
    Contains 1 TFIIS-type zinc finger.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human TFIISH protein images

  • 12.5% SDS-PAGE showing ab117000 at approx. 64.39 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human TFIISH protein (ab117000)

ab117000 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"