Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQ STKVPSLFVTKEGTNDGWKSAAHIYQVFLNAFCIHASMFFLGLDSISCLC
    • Molecular weight
      37 kDa including tags
    • Amino acids
      152 to 251

Specifications

Our Abpromise guarantee covers the use of ab152742 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Anti convertin
    • EPI
    • Extrinsic pathway inhibitor
    • LACI
    • Lipoprotein associated coagulation inhibitor
    • Lipoprotein-associated coagulation inhibitor
    • TFI
    • TFPI
    • TFPI 1
    • TFPI1
    • TFPI1_HUMAN
    • Tissue factor pathway inhibitor
    • Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor)
    see all
  • Function
    Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
  • Tissue specificity
    Mostly in endothelial cells.
  • Sequence similarities
    Contains 3 BPTI/Kunitz inhibitor domains.
  • Domain
    This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa.
  • Post-translational
    modifications
    O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152742 stained with Coomassie Blue.

References

ab152742 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152742.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up