Overview

  • Product name
    Recombinant Human TFPT protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSG GLGGSGLRERDEEEEAARGRRRRQRELNRRKYQALGRRCREIEQVNERVL NRLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVLEDEGSQGTDA PTPGNAENEPPEKETLSPPRRTPAPPEPGSPAPGEGPSGRKRRRVPRDGR RAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDKLLPYPTLASP ASD
    • Amino acids
      1 to 253
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amida
    • INO80 complex subunit F
    • INO80F
    • Protein FB1
    • TCF3 (E2A) fusion partner (in childhood Leukemia)
    • TCF3 fusion partner
    • TFPT
    • TFPT_HUMAN
    see all
  • Function
    Appears to promote apoptosis in a p53/TP53-independent manner.
    Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
  • Involvement in disease
    Note=A chromosomal aberration involving TFPT is a cause of pre-B-cell acute lymphoblastic leukemia (B-ALL). Inversion inv(19)(p13;q13) with TCF3.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab162243 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up