Recombinant Human TGF alpha protein (ab152745)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
    • Molecular weight
      31 kDa including tags
    • Amino acids
      42 to 89

Specifications

Our Abpromise guarantee covers the use of ab152745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EGF like TGF
    • EGF-like TGF
    • ETGF
    • TFGA
    • TGF A
    • TGF type 1
    • TGF-alpha
    • Tgfa
    • TGFA_HUMAN
    • Transforming growth factor alpha
    • Transforming growth factor alpha precursor
    • Wa1
    • Waved 1
    see all
  • Function
    TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
  • Tissue specificity
    Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
  • Sequence similarities
    Contains 1 EGF-like domain.
  • Cellular localization
    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152745 stained with Coomassie Blue.

References

ab152745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up