Recombinant Human TGF beta 1 protein (ab166886)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS
    • Molecular weight
      13 kDa
    • Amino acids
      279 to 390
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituents: PBS, 50% Glycerol

General Info

  • Alternative names
    • Cartilage-inducing factor
    • CED
    • Differentiation inhibiting factor
    • DPD1
    • LAP
    • Latency-associated peptide
    • Prepro transforming growth factor beta 1
    • TGF beta
    • TGF beta 1
    • TGF beta 1 protein
    • TGF-beta 1 protein
    • TGF-beta-1
    • TGF-beta-5
    • TGF-beta1
    • TGFB
    • Tgfb-1
    • tgfb1
    • TGFB1_HUMAN
    • TGFbeta
    • TGFbeta1
    • Transforming Growth Factor b1
    • Transforming Growth Factor beta 1
    • Transforming growth factor beta 1a
    • transforming growth factor beta-1
    • transforming growth factor, beta 1
    • Transforming Growth Factor-ß1
    see all
  • Function
    Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
  • Tissue specificity
    Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage.
  • Involvement in disease
    Defects in TGFB1 are the cause of Camurati-Engelmann disease (CE) [MIM:131300]; also known as progressive diaphyseal dysplasia 1 (DPD1). CE is an autosomal dominant disorder characterized by hyperostosis and sclerosis of the diaphyses of long bones. The disease typically presents in early childhood with pain, muscular weakness and waddling gait, and in some cases other features such as exophthalmos, facial paralysis, hearing difficulties and loss of vision.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Post-translational
    modifications
    Glycosylated.
    The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab166886.

References

ab166886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up