Recombinant Human TGFBI protein (ab51281)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF APTNEAFRA LPPRERSRLLGDAKELANILKYHIGDEILV SGGIGALVRLKSLQGDKL EVSLKNNVVSVNKEPVAEPDI MATNGVVHVITNVLQPPA
    • Amino acids
      502 to 636

Specifications

Our Abpromise guarantee covers the use of ab51281 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    This protein was purified by using conventional chromatography techniques
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20mM Tris, pH 8

General Info

  • Alternative names
    • RGD containing collagen associated protein
    • AI181842
    • AI747162
    • Beta ig
    • Beta ig h3
    • Beta ig-h3
    • BGH3_HUMAN
    • Big h3
    • BIGH3
    • CDB1
    • CDG2
    • CDGG1
    • CSD
    • CSD1
    • CSD2
    • CSD3
    • EBMD
    • Kerato epithelin
    • Kerato-epithelin
    • LCD1
    • MGC150270
    • RGD CAP
    • RGD-CAP
    • RGD-containing collagen-associated protein
    • TGFBI
    • TGFBI transforming growth factor, beta induced, 68kDa
    • Transforming growth factor beta induced protein ig h3
    • Transforming growth factor-beta-induced protein ig-h3
    see all
  • Function
    Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.
  • Tissue specificity
    Highly expressed in the corneal epithelium.
  • Involvement in disease
    Defects in TGFBI are the cause of epithelial basement membrane corneal dystrophy (EBMD) [MIM:121820]; also known as Cogan corneal dystrophy or map-dot-fingerprint type corneal dystrophy. EBMD is a bilateral anterior corneal dystrophy characterized by grayish epithelial fingerprint lines, geographic map-like lines, and dots (or microcysts) on slit-lamp examination. Pathologic studies show abnormal, redundant basement membrane and intraepithelial lacunae filled with cellular debris. Although this disorder usually is not considered to be inherited, families with autosomal dominant inheritance have been identified.
    Defects in TGFBI are the cause of corneal dystrophy Groenouw type 1 (CDGG1) [MIM:121900]; also known as corneal dystrophy granular type. Inheritance is autosomal dominant. Corneal dystrophies show progressive opacification of the cornea leading to severe visual handicap.
    Defects in TGFBI are the cause of corneal dystrophy lattice type 1 (CDL1) [MIM:122200]. Inheritance is autosomal dominant.
    Defects in TGFBI are a cause of corneal dystrophy Thiel-Behnke type (CDTB) [MIM:602082]; also known as corneal dystrophy of Bowman layer type 2 (CDB2).
    Defects in TGFBI are the cause of Reis-Buecklers corneal dystrophy (CDRB) [MIM:608470]; also known as corneal dystrophy of Bowman layer type 1 (CDB1).
    Defects in TGFBI are the cause of lattice corneal dystrophy type 3A (CDL3A) [MIM:608471]. CDL3A clinically resembles to lattice corneal dystrophy type 3, but differs in that its age of onset is 70 to 90 years. It has an autosomal dominant inheritance pattern.
    Defects in TGFBI are the cause of Avellino corneal dystrophy (ACD) [MIM:607541]. ACD could be considered a variant of granular dystrophy with a significant amyloidogenic tendency. Inheritance is autosomal dominant.
  • Sequence similarities
    Contains 1 EMI domain.
    Contains 4 FAS1 domains.
  • Post-translational
    modifications
    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix. May be associated both with microfibrils and with the cell surface.
  • Information by UniProt

Images

  • ab52181 run on a 15% SDS-PAGE gel with molecular weight markers. Predicted MW:14.5 KDa

References

ab51281 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you so much for contacting us and bringing this error to our attention. I have checked our documentation, and this is actually a BIGH3 protein, not TGF beta. The sequence on the datasheet is correct. I have alerted my colleagues in our business d...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up